PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29491.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 155aa    MW: 18266.4 Da    PI: 9.9177
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29491.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-12246347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT eE+++++ + ++lG+g+W+ I+  +  +Rt  q+ s+ qk+
        PK29491.1  2 AWTVEEHKRFLIGLEKLGKGDWRGISTNFVHTRTSTQVASHAQKF 46
                     7*****************************9************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015577.7E-15149IPR006447Myb domain, plants
PfamPF002494.8E-10145IPR001005SANT/Myb domain
PROSITE profilePS5129417.867151IPR017930Myb domain
SuperFamilySSF466891.94E-14252IPR009057Homeodomain-like
CDDcd001671.67E-6247No hitNo description
Gene3DG3DSA:1.10.10.602.7E-9242IPR009057Homeodomain-like
SMARTSM007173.8E-4249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MAWTVEEHKR FLIGLEKLGK GDWRGISTNF VHTRTSTQVA SHAQKFFNRH TNIYKINRRR  60
SSLLDMGGDK IFYKRGEKFD EKTSNYTKST YFDDVLKINH LERPIYMNNE YKYDHDDDYK  120
HHHSSPTSHK HHHSSPTSEL ELKLGAPNTS NTITK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443842.17e-27hypothetical protein SORBIDRAFT_07g003170
TrEMBLC5YN418e-27C5YN41_SORBI; Putative uncharacterized protein Sb07g003170
STRINGSb07g003170.12e-26(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1852625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.17e-27MYB_related family protein